ТРАЙДЕКС

Содержание
  1. Interactions
  2. Pharmacology
  3. COMPLETE LABELING
  4. Product labeling at DailyMed, National Library of Medicine, NIH
  5. References updated: 06 June 2018
  6. Ilowite NT, Prather K, Lokhnygina Y, Schanberg LE, Elder M, Milojevic D, Verbsky JW, et al. Randomized, double-blind, placebo-controlled trial of the efficacy and safety of rilonacept in the treatment of systemic juvenile idiopathic arthritis. Arthritis Rheumatol 2014; 66: 2570-9. PubMed Citation  (Among 50 children with juvenile idiopathic arthritis treated with rilonacept or placebo for 4 weeks and then with open label rilonacept for up to 24 weeks, response rates were higher with rilonacept, and 4 receiving rilonacept developed elevated ALT levels that were above 5 times ULN in 2 ).
  7. Sundy JS, Schumacher HR, Kivitz A, Weinstein SP, Wu R, King-Davis S, Evans RR. Rilonacept for gout flare prevention in patients receiving uric acid-lowering therapy: results of RESURGE, a phase III, international safety study. J Rheumatol 2014; 41: 1703-11. PubMed Citation  (Among 1315 adults with gout treated with rilonacept or placebo for 16 weeks, rilonacept was associated with fewer gout flares but higher rates of ALT elevations ).
  8. Chalasani N, Bonkovsky HL, Fontana R, Lee W, Stolz A, Talwalkar J, Reddy KR, et al.; United States Drug Induced Liver Injury Network. Features and outcomes of 899 patients with drug-induced liver injury: The DILIN Prospective Study. Gastroenterology 2015; 148: 1340-52.e7.PubMed Citation (Among 899 cases of drug induced liver injury enrolled in a US prospective study between 2004 and 2013, none were attributed to rilonacept or other IL-1 antagonists).
  9. Winthrop KL, Mariette X, Silva JT, Benamu E, Calabrese LH, Dumusc A, Smolen JS, et al. ESCMID Study Group for Infections in Compromised Hosts (ESGICH) Consensus Document on the safety of targeted and biological therapies: an infectious diseases perspective (Soluble immune effector molecules : agents targeting interleukins, immunoglobulins and complement factors). Clin Microbiol Infect 2018; 24 Suppl 2: S21-S40. PubMed Citation  (Review of the risk of infections in patients receiving biologic therapies targeting interleukins and immunoglobulins concludes that patients taking IL-1 targeted agents have a moderate increased risk for infections, should be  prescreened for tuberculosis and monitored for infections during therapy).
  10. Arcalyst
  11. Indications
  12. Therapeutic effects
  13. Pharmacokinetics
  14. Contraindications/Precautions
  15. Route/Dosage
  16. Nursing implications
  17. Nursing assessment
  18. Implementation
  19. Patient/Family Teaching
  20. Evaluation/Desired Outcomes
  21. Taxonomy
  22. Targets
  23. References
  24. Clinical Trials
  25. Identification

Interactions

Drug Interactions

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

Drug Interaction
Unlock Additional Data
(R)-warfarin The metabolism of (R)-warfarin can be increased when combined with Rilonacept.
(S)-Warfarin The metabolism of (S)-Warfarin can be increased when combined with Rilonacept.
2-Methoxyethanol The risk or severity of adverse effects can be increased when 2-Methoxyethanol is combined with Rilonacept.
3,5-diiodothyropropionic acid The metabolism of 3,5-diiodothyropropionic acid can be increased when combined with Rilonacept.
4-hydroxycoumarin The metabolism of 4-hydroxycoumarin can be increased when combined with Rilonacept.
4-Methoxyamphetamine The metabolism of 4-Methoxyamphetamine can be increased when combined with Rilonacept.
5-androstenedione The metabolism of 5-androstenedione can be increased when combined with Rilonacept.
5-methoxy-N,N-dimethyltryptamine The metabolism of 5-methoxy-N,N-dimethyltryptamine can be increased when combined with Rilonacept.
6-O-benzylguanine The metabolism of 6-O-benzylguanine can be increased when combined with Rilonacept.
7-ethyl-10-hydroxycamptothecin The metabolism of 7-ethyl-10-hydroxycamptothecin can be increased when combined with Rilonacept.

Additional Data Available

  • Extended Description

    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more

  • Severity

    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more

  • Evidence Level

    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more

  • Action

    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more

Food Interactions
Not Available
Заготовки из капусты

Pharmacology

Indication

Rilonacept is currently used in the treatment of cryopyrin-associated periodic syndrome. In May 2012, an advisory panel for the FDA voted 11-0 against the use of Rilonacept for the treatment of gout.

Associated Conditions
  • Cryopyrin-associated Periodic Syndromes (CAPS)
  • Familial Cold Autoinflammatory Syndrome (FCAS)
  • Muckle-Wells Syndrome (MWS)
Pharmacodynamics

Treatment with Rilonacept resulted in decreased levels of mean C-Reactive Protein (CRP) and Serum Amyloid A (SAA). Higher levels of CRP and SAA are associated with inflammatory disease activity found in patients with Cryopyrin-Associated Periodic Syndromes.

Mechanism of action

CAPS refer to rare genetic syndromes generally caused by mutations in the NLRP-3 gene (also known as Cold-Induced Auto-inflammatory Syndtrome-1 ). CAPS disorders are inherited in an autosomal dominant pattern with male and female offspring equally affected. Fever, urticaria-like rash, arthralgia, myalgia, fatigue, and conjunctivitis are features common to all disorders. In most cases, inflammation in CAPS is associated with mutations in the NLRP-3 gene which encodes the protein cryopyrin, an important component of the inflammasome. Cryopyrin regulates the protease caspase-1 and controls the activation of interleukin-1 beta (IL-1β). Mutations in NLRP-3 result in an overactive inflammasome resulting in excessive release of activated IL-1β that drives inflammation. Rilonacept blocks IL-1β signaling by acting as a soluble decoy receptor that binds IL-1β and prevents its interaction with cell surface receptors. Rilonacept also binds IL-1α and IL-1 receptor antagonist (IL-1ra) with reduced affinity. By binding IL-1, rilonacept prevents the activation of IL-1 receptors, thus reducing inflammatory responses and other effects related to an excess of IL-1.

Target Actions Organism
U binder Humans
U binder Humans
U binder Humans

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more

Additional Data Available

Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more

Additional Data Available

Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more

Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

8.6 days

Clearance
Not Available
Toxicity
Not Available
Affected organisms

Pathways
Not Available
Pharmacogenomic Effects/ADRs

Not Available

COMPLETE LABELING

Product labeling at DailyMed, National Library of Medicine, NIH

CHEMICAL FORMULA AND STRUCTURE
Rilonacept

DRUG CAS REGISTRY NO. MOLECULAR FORMULA STRUCTURE
Rilonacept 501081-76-1 C9030-H13932-N2400-O2670-S74 No Structure

ANNOTATED BIBLIOGRAPHY
Rilonacept

References updated: 06 June 2018

  1. Ilowite NT, Prather K, Lokhnygina Y, Schanberg LE, Elder M, Milojevic D,
    Verbsky JW, et al. Randomized, double-blind, placebo-controlled trial of the
    efficacy and safety of rilonacept in the treatment of systemic juvenile
    idiopathic arthritis. Arthritis Rheumatol 2014; 66: 2570-9. PubMed Citation  (Among 50 children with juvenile idiopathic arthritis treated with rilonacept or placebo for 4 weeks and then with open label rilonacept for up to 24 weeks, response rates were higher with rilonacept, and 4 receiving rilonacept developed elevated ALT levels that were above 5 times ULN in 2 ).

  2. Sundy JS, Schumacher HR, Kivitz A, Weinstein SP, Wu R, King-Davis S, Evans RR.
    Rilonacept for gout flare prevention in patients receiving uric acid-lowering
    therapy: results of RESURGE, a phase III, international safety study. J
    Rheumatol 2014; 41: 1703-11. PubMed Citation  (Among 1315 adults with gout treated with rilonacept or placebo for 16 weeks, rilonacept was associated with fewer gout flares but higher rates of ALT elevations ).

  3. Chalasani N, Bonkovsky HL, Fontana R, Lee W, Stolz A, Talwalkar J, Reddy KR, et al.; United States Drug Induced Liver Injury Network. Features and outcomes of 899 patients with drug-induced liver injury: The DILIN Prospective Study. Gastroenterology 2015; 148: 1340-52.e7.PubMed Citation (Among 899 cases of drug induced liver injury enrolled in a US prospective study between 2004 and 2013, none were attributed to rilonacept or other IL-1 antagonists).

  4. Winthrop KL, Mariette X, Silva JT, Benamu E, Calabrese LH, Dumusc A, Smolen
    JS, et al. ESCMID Study Group for Infections in Compromised
    Hosts (ESGICH) Consensus Document on the safety of targeted and biological
    therapies: an infectious diseases perspective (Soluble immune effector molecules
    : agents targeting interleukins, immunoglobulins and complement factors).
    Clin Microbiol Infect 2018; 24 Suppl 2: S21-S40. PubMed Citation  (Review of the risk of infections in patients receiving biologic therapies targeting interleukins and immunoglobulins concludes that patients taking IL-1 targeted agents have a moderate increased risk for infections, should be  prescreened for tuberculosis and monitored for infections during therapy).

OTHER REFERENCE LINKS
Rilonacept

Помидоры с горчицей

Arcalyst

Indications

Treatment of Cryopyrin-Associated Periodic Syndromes (CAPS), including Familial Cold Autoinflammatory Syndrome (FCAS) and Muckle-Wells Syndrome (MWS).

Therapeutic effects

Decreased inflammatory manifestations of CAPS including fever, rash, arthralgia, myalgia, fatigue and conjunctivitis.

Pharmacokinetics

Absorption: Absorbed following subcutaneous administration.

Distribution: Unknown.

Metabolism and Excretion: Unknown.

Half-life: Unknown.

Contraindications/Precautions

Contraindicated in: Active or chronic infections; Obstetric: May cause fetal harm.

Use Cautiously in: Patients at risk of infections; Lactation: Use cautiously; Pediatric: Safety and effectiveness have not been established in children

  • serious life-threatening infections (life-threatening)
  • hypersensitivity reactions

Route/Dosage

Subcutaneous (Adults ≥18 yr) 320 mginitially, followed by 160 mg weekly.

Subcutaneous (Children and adolescents 12–17 yr) 4.4 mg/kg (not to exceed 320 mg) initially, followed by 2.2 mg/kg (not to exceed 160 mg) weekly.

Nursing implications

Nursing assessment

  • Assess for signs of infections. Discontinue therapy if serious infection occurs. Do not administer to patients with active or chronic infections.
  • Assess for signs of hypersensitivity reactions; institute symptomatic therapy.
  • .
  • Lab Test Considerations: Monitor lipid profiles every 2–3 mo during therapy. May cause ↑total cholesterol, HDL, LDL, and triglycerides. Consider lipid lowering therapies as needed.

Implementation

  • Administer all recommended adult and pediatric vaccinations, including pneumococcal vaccine and inactivated influenza vaccine, prior to starting rilonacept therapy.
  • Administer first dose under supervision of health care professional.
  • Loading dose in adults is given as two 2 mL injections on the same day in 2 different injection sites. In pediatric patients 1 or 2 injections may be used. Do not administer more than once weekly or more then 2 mL/injection site.
  • Reconstitute with 2.3 mL of Sterile water for injection using a 27-gauge 1/2 inch needle for a concentration of 80 mg/mL. Discard needle and syringe after reconstitution. Shake vial for 1 min and allow to sit for 1 min. Solution is viscous, clear, colorless to pale yellow. Do not administer solutions that are discolored, contain particulate matter, or are passed the expiration date. Withdraw recommended dose up to 2 mL with new 27-gauge 1/2 inch needle. Vials are single use; discard unused solution. Rilonacept must be refrigerated and protected from light. Reconstituted solution is stable for 3 hrs at room temperature.
  • Subcutaneous: Inject subcut into abdomen (avoid area within 2 inches of navel), thigh or upper arm by pinching skin and injecting at a 90° (45° angle for small children or persons with little fat). May require 30 seconds to inject entire dose. Pull needle out of skin and hold gauze over site for several seconds. Rotate sites and avoid sites that are bruised, red, tender or hard.
Кладоспориоз томатов

Patient/Family Teaching

  • Instruct patient or family on correct technique for preparing and administering injection, and disposing of equipment. If a dose is missed, administer up to the day before next scheduled dose. Take next dose at regularly scheduled time. Advise patient to read Patient Information prior to starting therapy and with each Rx refill in case of new information.
  • Advise patient to notify health care professional immediately if signs of infection (fever, cough, flu-like symptoms, open sores) occur during therapy.
  • Instruct patient to notify health care professional or seek emergency care if signs of allergic reaction (rash, swollen face, difficulty breathing) occur.
  • Advise patient that injection site reactions (erythema, swelling pruritus, bruising, inflammation, pain, edema, dermatitis, urticaria, vesicles, warmth, and hemorrhage) may occur; usually resolve in 1–2 days. Notify health care professional if reaction is persistent.
  • Instruct patient to consult health care professional prior to taking other Rx, OTC, or herbal products.
  • Advise female patients to notify health care professional if pregnancy is planned or suspected or if breastfeeding.

Evaluation/Desired Outcomes

Decrease in symptoms (rash, joint pain, fever, tiredness), decrease in and normalization of serum Amyloid A (SAA) and C-Reactive Protein (CRP) levels.

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Details1. Interleukin-1 beta

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Binder
General Function
Protein domain specific binding
Specific Function
Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, …
Gene Name
IL1B
Uniprot ID
P01584
Uniprot Name
Interleukin-1 beta
Molecular Weight
30747.7 Da
References
  1. Tran TH, Pham JT, Shafeeq H, Manigault KR, Arya V: Role of interleukin-1 inhibitors in the management of gout. Pharmacotherapy. 2013 Jul;33(7):744-53. doi: 10.1002/phar.1265. Epub 2013 Apr 3.
  2. Cronstein BN, Sunkureddi P: Mechanistic aspects of inflammation and clinical management of inflammation in acute gouty arthritis. J Clin Rheumatol. 2013 Jan;19(1):19-29. doi: 10.1097/RHU.0b013e31827d8790.

Details2. Interleukin-1 alpha

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Binder
General Function
Cytokine activity
Specific Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are in…
Gene Name
IL1A
Uniprot ID
P01583
Uniprot Name
Interleukin-1 alpha
Molecular Weight
30606.29 Da
References
  1. Tran TH, Pham JT, Shafeeq H, Manigault KR, Arya V: Role of interleukin-1 inhibitors in the management of gout. Pharmacotherapy. 2013 Jul;33(7):744-53. doi: 10.1002/phar.1265. Epub 2013 Apr 3.
  2. Cronstein BN, Sunkureddi P: Mechanistic aspects of inflammation and clinical management of inflammation in acute gouty arthritis. J Clin Rheumatol. 2013 Jan;19(1):19-29. doi: 10.1097/RHU.0b013e31827d8790.

Details3. Interleukin-1 receptor antagonist protein

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Binder
General Function
Interleukin-1, type ii receptor binding
Specific Function
Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional int…
Gene Name
IL1RN
Uniprot ID
P18510
Uniprot Name
Interleukin-1 receptor antagonist protein
Molecular Weight
20054.82 Da
Как закоптить утку в домашних условиях
References
  1. Hawkins PN, Lachmann HJ, McDermott MF: Interleukin-1-receptor antagonist in the Muckle-Wells syndrome. N Engl J Med. 2003 Jun 19;348(25):2583-4.
  2. Cronstein BN, Sunkureddi P: Mechanistic aspects of inflammation and clinical management of inflammation in acute gouty arthritis. J Clin Rheumatol. 2013 Jan;19(1):19-29. doi: 10.1097/RHU.0b013e31827d8790.

Drug created on March 19, 2008 10:27 / Updated on September 02, 2019 18:19

References

Synthesis Reference

Rilonacept is expressed in recombinant Chinese hamster ovary (CHO) cells.

General References
  1. Hoffman HM, Throne ML, Amar NJ, Cartwright RC, Kivitz AJ, Soo Y, Weinstein SP: Long-term efficacy and safety profile of rilonacept in the treatment of cryopryin-associated periodic syndromes: results of a 72-week open-label extension study. Clin Ther. 2012 Oct;34(10):2091-103. doi: 10.1016/j.clinthera.2012.09.009. Epub 2012 Sep 29.
  2. Tran TH, Pham JT, Shafeeq H, Manigault KR, Arya V: Role of interleukin-1 inhibitors in the management of gout. Pharmacotherapy. 2013 Jul;33(7):744-53. doi: 10.1002/phar.1265. Epub 2013 Apr 3.
  3. Hawkins PN, Lachmann HJ, McDermott MF: Interleukin-1-receptor antagonist in the Muckle-Wells syndrome. N Engl J Med. 2003 Jun 19;348(25):2583-4.
  4. Cronstein BN, Sunkureddi P: Mechanistic aspects of inflammation and clinical management of inflammation in acute gouty arthritis. J Clin Rheumatol. 2013 Jan;19(1):19-29. doi: 10.1097/RHU.0b013e31827d8790.
External Links
KEGG Drug
D06635
PubChem Substance
ChEMBL
CHEMBL1201830
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Rilonacept
ATC Codes
L04AC04 — Rilonacept
  • L04AC — Interleukin inhibitors
  • L04A — IMMUNOSUPPRESSANTS
  • L04 — IMMUNOSUPPRESSANTS
  • L — ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS
FDA label
Download (148 KB)
MSDS
Download (568 KB)

Clinical Trials

Clinical Trials
Recruiting Treatment Autoimmune Neurosensory Hearing Loss (ANSHL)
1 Completed Treatment Systemic Juvenile Idiopathic Arthritis (SJIA)
1 Completed Treatment Type 1 Insulin-Dependent Diabetes Mellitus
1, 2 Completed Treatment Diffuse Systemic Sclerosis Scleroderma Sclerosis, Progressive Systemic
2 Completed Treatment Acute Gouty Arthritis
2 Completed Treatment Alcoholic Hepatitis (AH)
2 Completed Treatment Atherosclerosis Coronary Artery Disease Endothelial Dysfunction Inflammatory Reaction
2 Completed Treatment Cardiovascular Disease (CVD) Chronic Kidney Disease (CKD)
2 Completed Treatment Cold Contact Urticaria
2 Completed Treatment DIRA
2 Completed Treatment Familial Mediterranean Fever (FMF )
2 Completed Treatment Juvenile Idiopathic Arthritis (JIA)
2 Completed Treatment Muckle-Wells Syndrome (MWS) Schnitzler’s Syndrome
2 Completed Treatment Recurrent Pericarditis
2 Withdrawn Treatment Anemias Chronic Kidney Disease (CKD)
3 Completed Prevention Acute Gouty Arthritis
3 Completed Treatment Acute Gout Flare
3 Completed Treatment Acute Gouty Arthritis
3 Completed Treatment Familial Cold Autoinflammatory Syndrome (FCAS) Genetic Diseases, Inborn Muckle-Wells Syndrome (MWS)
3 Completed Treatment Intercritical Gout
3 Recruiting Treatment Recurrent Pericarditis
3 Terminated Treatment Acute Gouty Arthritis
4 Completed Prevention Renal Insufficiency,Chronic
Not Available Completed Treatment Subacromial Bursitis

Identification

Name
Rilonacept
Accession Number
DB06372
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based TherapiesFusion proteins
Description

Rilonacept is a dimeric fusion protein consisting of portions of IL-1R and the IL-1R accessory protein linked to the Fc portion of immunoglobulin G1. Rilonacept functions as an interleukin 1 inhibitor and is used in the treatment of CAPS, also known as cryopyrin-associated periodic syndromes, including familial cold auto-inflammatory syndrome (FCAS) and Muckle-Wells Syndrome (MWS), in adults and children greater than 12 years old.

Protein chemical formula
C9030H13932N2400O2670S74
Protein average weight
251000.0 Da
Sequences
>8750_M|rilonacept|Homo sapiens||FUSION-IL1RAP-IL1R1-GAMMA-1 (IL1RAP+(Pr21-359)(1-339)+IL1R1+(Pr22-333)(340-651)+HINGE-REGION(652-663)+CH2(664-773)+CH3(774-880))|||||||880||||MW 100630.6|MW 100630.6|
SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLE
EPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFL
IALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGE
ELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKK
VTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEKCKEREEKIILVSSANEIDVR
PCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSS
YCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYK
DCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENK
PTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVE
NPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNSGDKTHTCP
PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA
KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY
SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Download FASTA Format

Synonyms
Prescription Products

Additional Data Available

  • Application Number

    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more

  • Product Code

    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories
  • Agents reducing cytokine levels
  • Amino Acids, Peptides, and Proteins
  • Anti-Inflammatory Agents
  • Antineoplastic and Immunomodulating Agents
  • Immunosuppressive Agents
  • Interleukin Inhibitors
  • Interleukin-1 Receptor Accessory Protein
  • Proteins
  • Receptors, Interleukin-1 Type I
  • Recombinant Proteins
UNII
8K80YB5GMG
CAS number
501081-76-1


Уважаемые читатели, подписывайтесь на наш канал в Яндекс.Дзен. Нажмите "Подписаться на канал", чтобы получать все самые лучшие материалы к себе в ленту.



Понравилась статья? Поделиться с друзьями:
Добавить комментарий

;-) :| :x :twisted: :smile: :shock: :sad: :roll: :razz: :oops: :o :mrgreen: :lol: :idea: :grin: :evil: :cry: :cool: :arrow: :???: :?: :!:

Закрыть